Recombinant Mouse Small proline-rich protein 2A (Sprr2a) | CSB-EP022612MO

Recombinant Mouse Small proline-rich protein 2A (Sprr2a) | CSB-EP022612MO | Cusabio

Alternative Name(s): Sprr2a1; Sprr2a; Small proline-rich protein 2A1; small proline-rich protein 2A

Gene Names: Sprr2a

Research Areas: Signal Transduction

Organism: Mus musculus (Mouse)

AA Sequence: MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-83aa

Sequence Info: Full Length

MW: 13.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane

Reference: "Mouse Sprr2 genes: a clustered family of genes showing differential expression in epithelial tissues."Song H.J., Poy G., Darwiche N., Lichti U., Kuroki T., Steinert P.M., Kartasova T.Genomics 55:28-42(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane (By similarity).

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Cornifin (SPRR) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9CQK8

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A