Recombinant Mouse Scrapie-responsive protein 1 (Scrg1) | CSB-EP526023MOa0

Recombinant Mouse Scrapie-responsive protein 1 (Scrg1) | CSB-EP526023MOa0 | Cusabio

Alternative Name(s): Scrapie-responsive gene 1 protein (ScRG-1) ()

Gene Names: Scrg1

Research Areas: Developmental Biology

Organism: Mus musculus (Mouse)

AA Sequence: MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 21-98aa

Sequence Info: Full Length of Mature Protein

MW: 15.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "Scrg1, a novel protein of the CNS is targeted to the large dense-core vesicles in neuronal cells." Dandoy-Dron F., Griffond B., Mishal Z., Tovey M.G., Dron M. Eur. J. Neurosci. 18:2449-2459(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O88745

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A