Recombinant Mouse Ribonuclease inhibitor (Rnh1), partial | CSB-EP849647MO1

Recombinant Mouse Ribonuclease inhibitor (Rnh1), partial | CSB-EP849647MO1 | Cusabio

Alternative Name(s): Ribonuclease inhibitor(Ribonuclease/angiogenin inhibitor 1)

Gene Names: Rnh1

Research Areas: Cardiovascular

Organism: Mus musculus (Mouse)

AA Sequence: SLDIQCEQLSDARWTELLPLIQQYEVVRLDDCGLTEVRCKDISSAVQANPALTELSLRTNELGDGGVGLVLQGLQNPTCKIQKLSLQNCGLTEAGCGILPGMLRSLSTLRELHLNDNPMGDAGLKLLCEGLQDPQCRLEKLQLEYCNLTATSCEPLASVLRVKADFKELVLSNNDLHEPGVRILCQGLKDSACQLESLKLENCGITAANCKDLCDVVASKASLQELDLSSNKLGNAGIAALCPGLLLPSCKLRTLWLWECDITAEGCKDLCRVLRAKQSLKELSLASNELKDEGARLLCESLLEPGCQLESLWIKSCSLTAASCPYFCSVLTKSRSLLELQMSSNPLGDEGVQELCKALSQPDTVLRELWLGDCDVTNSGCSSLANVLLANRSLRELDLSNNCMGGPGVLQLLESLKQPSCTLQQLVLYDIYWTNEVEEQLRALEEERPSLRIIS

Source: E.coli

Tag Info: N-terminal 6xHis-MBP-tagged

Expression Region: 2-456aa

Sequence Info: Partial

MW: 93.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Ribonuclease inhibitor which inhibits RNASE1, RNASE2 and ANG. May play a role in redox homeostasis (By similarity).

Reference: "Ribonuclease inhibitor 1 regulates erythropoiesis by controlling GATA1 translation." Chennupati V., Veiga D.F., Maslowski K.M., Andina N., Tardivel A., Yu E.C., Stilinovic M., Simillion C., Duchosal M.A., Quadroni M., Roberts I., Sankaran V.G., MacDonald H.R., Fasel N., Angelillo-Scherrer A., Schneider P., Hoang T., Allam R. J Clin Invest 128:1597-1614(2018)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q91VI7

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A