Cusabio Mouse Recombinants
Recombinant Mouse Osteocalcin (Bglap) | CSB-EP002682MO
- SKU:
- CSB-EP002682MO
- Availability:
- 3 - 7 Working Days
Description
Recombinant Mouse Osteocalcin (Bglap) | CSB-EP002682MO | Cusabio
Alternative Name(s): Bone Gla protein Short name: BGP Gamma-carboxyglutamic acid-containing protein
Gene Names: Bglap
Research Areas: Signal Transduction
Organism: Mus musculus (Mouse)
AA Sequence: YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 50-95aa
Sequence Info: Full Length of Mature Protein
MW: 21.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
Reference: "The mouse osteocalcin gene cluster contains three genes with two separate spatial and temporal patterns of expression."Desbois C., Hogue D.A., Karsenty G.J. Biol. Chem. 269:1183-1190(1994)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Osteocalcin/matrix Gla protein family
Tissue Specificity: Bone.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P86546
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A