Cusabio Mouse Recombinants
Recombinant Mouse Major urinary protein 2 (Mup2) | CSB-EP319316MO
- SKU:
- CSB-EP319316MO
- Availability:
- 13 - 23 Working Days
Description
Recombinant Mouse Major urinary protein 2 (Mup2) | CSB-EP319316MO | Cusabio
Alternative Name(s): Mup2; Major urinary protein 2; MUP 2
Gene Names: Mup2
Research Areas: Others
Organism: Mus musculus (Mouse)
AA Sequence: EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 19-180aa
Sequence Info: Full Length of Mature Protein
MW: 22.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales.
Reference: Complete 1H, 15N and 13C assignment of a recombinant mouse major urinary protein.Abbate F., Franzoni L., Lohr F., Luecke C., Ferrari E., Sorbi R.T., Rueterjans H., Spisni A.J. Biomol. NMR 15:187-188(1999)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Calycin superfamily, Lipocalin family
Tissue Specificity: Abundant in the urine of adult male mice but absent from that of females.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P11589
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A