Cusabio Mouse Recombinants
Recombinant Mouse Lymphocyte antigen 6G (Ly6g), partial | CSB-YP333994MOa4
- SKU:
- CSB-YP333994MOa4
- Availability:
- 3 - 7 Working Days
Description
Recombinant Mouse Lymphocyte antigen 6G (Ly6g), partial | CSB-YP333994MOa4 | Cusabio
Alternative Name(s): Ly-6G.1
Gene Names: Ly6g
Research Areas: Others
Organism: Mus musculus (Mouse)
AA Sequence: LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG
Source: Yeast
Tag Info: N-terminal 6xHis-sumostar-tagged
Expression Region: 27-119aa
Sequence Info: Partial
MW: 25.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: "The monoclonal antibody TER-119 recognizes a molecule associated with glycophorin A and specifically marks the late stages of murine erythroid lineage." Kina T., Ikuta K., Takayama E., Wada K., Majumdar A.S., Weissman I.L., Katsura Y. Br. J. Haematol. 109:280-287(2000)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor
Protein Families:
Tissue Specificity: Expressed in bone marrow.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P35461
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: STRING
OMIM Database Link: N/A