Recombinant Mouse Lymphocyte antigen 6G (Ly6g), partial | CSB-EP333994MOb0

Recombinant Mouse Lymphocyte antigen 6G (Ly6g), partial | CSB-EP333994MOb0 | Cusabio

Alternative Name(s): Ly-6G.1

Gene Names: Ly6g

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 27-119aa

Sequence Info: Partial

MW: 13.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Negligible role of antibodies and C5 in pregnancy loss associated exclusively with C3-dependent mechanisms through complement alternative pathway." Mao D., Wu X., Deppong C., Friend L.D., Dolecki G., Nelson D.M., Molina H. Immunity 19:813-822(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor

Protein Families:

Tissue Specificity: Expressed in bone marrow.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P35461

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A