Cusabio Mouse Recombinants
Recombinant mouse Interleukin-2 receptor subunit beta (Il2rb), partial | CSB-YP011650MO
- SKU:
- CSB-YP011650MO
- Availability:
- 3 - 7 Working Days
Description
Recombinant mouse Interleukin-2 receptor subunit beta (Il2rb), partial | CSB-YP011650MO | Cusabio
Alternative Name(s): High affinity IL-2 receptor subunit betap70-75; CD122
Gene Names: Il2rb
Research Areas: Others
Organism: Mus musculus (Mouse)
AA Sequence: AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 27-240aa
Sequence Info: Partial
MW: 27.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
Reference: Murine interleukin 2 receptor beta chain dysregulated gene expression in lymphoma line EL-4 caused by a promoter insertion.Kono T., Doi T., Yamada G., Hatakeyama M., Minamoto S., Tsudo M., Miyasaka M., Miyata T., Taniguchi T.Proc. Natl. Acad. Sci. U.S.A. 87:1806-1810(1990)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
Involvement in disease:
Subcellular Location: Membrane, Single-pass type I membrane protein
Protein Families: Type I cytokine receptor family, Type 4 subfamily
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P16297
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A