Recombinant Mouse Interleukin-13 (Il13), partial (Active) | CSB-AP004751MO

Recombinant Mouse Interleukin-13 (Il13) ,partial (Active) | CSB-AP004751MO | Cusabio

Protein Description: Partial

Alternative Name (s) : Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13

Gene Names: Il13

Research Areas: Immunology

Species: Mus musculus (Mouse)

Source: Mammalian cell

Tag Info: C-terminal 6xHis-tagged

Expression Region: 22-131aa

Sequence Info: PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Biological Activity: The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is less than 20 ng/ml.

MW: 13.1 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Mouse interleukin 13 (mIL-13) is a pleiotropic cytokine produced by activated Th2 cells. IL-13 induces B cell proliferation and immunoglobin production. It contains a four helical bundle with two internal disulfide bonds. Mouse IL13 shares 58% sequence identity with human protein and exhibits cross-species activity. IL13 signals via receptor IL13R (type2, IL4R) and activates STAT-6. IL13 initially binds IL-13Rα1 with low affinity and triggers association of IL4Rα, generating a high affinity heterodimeric receptor IL13R and eliciting downstream signals. IL13 also binds IL-13Rα2 with high affinity, which plays a role in a negative feedback system of IL13 signaling. IL13 is an important mediator of allergic inflammation and disease.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses (By similarity) . Positively regulates IL31RA expression in macrophages

Involvement in disease:

Subcellular Location: Secreted

Protein Families: IL-4/IL-13 family

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P20109

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A