Recombinant Mouse Interferon epsilon (Ifne) | CSB-EP800374MO

Recombinant Mouse Interferon epsilon (Ifne) | CSB-EP800374MO | Cusabio

Alternative Name(s): Interferon epsilon-1Interferon tau-1

Gene Names: Ifne

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 22-192aa

Sequence Info: Full Length of Mature Protein

MW: 36 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the fale reproductive tract. Directly mediates protection against viral, including HSV-2, and bacterial, including Chlamydia muridarum, genital infections.

Reference: Interferon-epsilon protects the female reproductive tract from viral and bacterial infection.Fung K.Y., Mangan N.E., Cumming H., Horvat J.C., Mayall J.R., Stifter S.A., De Weerd N., Roisman L.C., Rossjohn J., Robertson S.A., Schjenken J.E., Parker B., Gargett C.E., Nguyen H.P., Carr D.J., Hansbro P.M., Hertzog P.J.Science 339:1088-1092(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the female reproductive tract. Directly mediates protection against viral, including HSV-2, and bacterial, including Chlamydia muridarum, genital infections.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Alpha/beta interferon family

Tissue Specificity: Expressed at very high levels in uterus and, at much lower levels, in ovary and cervix. Very low levels, if any, in other organs. In the endometrium, expressed in the luminal and glandular epithelial cells (at protein level).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q80ZF2

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A