Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a) | CSB-CF008532MO

Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a) | CSB-CF008532MO | Cusabio

Alternative Name(s): Fc-epsilon RI-alpha

Gene Names: Fcer1a

Research Areas: Immunology

Organism: Mus musculus (Mouse)

AA Sequence: ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-SUMO-tagged

Expression Region: 24-250aa

Sequence Info: Full Length of Mature Protein

MW: 44.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.

Reference: "Transcription mapping and expression analysis of candidate genes in the vicinity of the mouse Loop-tail mutation." Underhill D.A., Vogan K.J., Kibar Z., Morrison J., Rommens J., Gros P. Mamm. Genome 11:633-638(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity: Expressed in bone marrow mast cells, as well as in the pineal gland at night.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P20489

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A