Recombinant Mouse Hemoglobin subunit alpha (Hba) | CSB-EP010147MO

Recombinant Mouse Hemoglobin subunit alpha (Hba) | CSB-EP010147MO | Cusabio

Alternative Name(s): Alpha-globinHemoglobin alpha chain

Gene Names: Hba

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-142aa

Sequence Info: Full Length of Mature Protein

MW: 19 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in oxygen transport from the lung to the various peripheral tissues.

Reference: SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in oxygen transport from the lung to the various peripheral tissues.

Involvement in disease:

Subcellular Location:

Protein Families: Globin family

Tissue Specificity: Red blood cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01942

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A