Recombinant Mouse Fibroblast growth factor 21 (Fgf21) | CSB-EP008627MO

Recombinant Mouse Fibroblast growth factor 21 (Fgf21) | CSB-EP008627MO | Cusabio

Alternative Name(s): Fgf21Fibroblast growth factor 21; FGF-21

Gene Names: Fgf21

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 29-210aa

Sequence Info: Full Length of Mature Protein

MW: 23.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity probably requires the presence of KLB.

Reference: Identification of a novel FGF, FGF-21, preferentially expressed in the liver.Nishimura T., Nakatake Y., Konishi M., Itoh N.Biochim. Biophys. Acta 1492:203-206(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity probably requires the presence of KLB.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Heparin-binding growth factors family

Tissue Specificity: Most abundantly expressed in the liver, also expressed in the thymus at lower levels.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9JJN1

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A