Cusabio Mouse Recombinants
Recombinant Mouse Fibroblast growth factor 20 (Fgf20) | CSB-EP008626MO
- SKU:
- CSB-EP008626MO
- Availability:
- 3 - 7 Working Days
Description
Recombinant Mouse Fibroblast growth factor 20 (Fgf20) | CSB-EP008626MO | Cusabio
Alternative Name(s): FGF-20
Gene Names: Fgf20
Research Areas: Cancer
Organism: Mus musculus (Mouse)
AA Sequence: MAPLTEVGAFLGGLEGLSQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT
Source: E.coli
Tag Info: Tag-Free
Expression Region: 1-211aa
Sequence Info: Full Length
MW: 23.6 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Neurotrophic factor that regulates central nervous development and function.
Reference: "Endocardial and epicardial derived FGF signals regulate myocardial proliferation and differentiation in vivo." Lavine K.J., Yu K., White A.C., Zhang X., Smith C., Partanen J., Ornitz D.M. Dev. Cell 8:85-95(2005)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9ESL9
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A