Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), Partial | CSB-EP006163MO1

Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), Partial | CSB-EP006163MO1 | Cusabio

Alternative Name(s): Cytotoxic T-lymphocyte-associated antigen 4

Gene Names: Ctla4

Research Areas: Immunology

Organism: Mus musculus (Mouse)

AA Sequence: EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 36-161aa

Sequence Info: Extracellular Domain

MW: 33.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28

Reference: "CTLA-4 and CD28 activated lymphocyte molecules are closely related in both mouse and human as to sequence, message expression, gene structure, and chromosomal location." Harper K., Balzano C., Rouvier E., Mattei M.-G., Luciani M.-F., Golstein P. J. Immunol. 147:1037-1044(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity: Widely expressed with highest levels in lymphoid tissues.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P09793

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A