Recombinant Mouse Cystatin-C (Cst3) | CSB-EP006091MO

(No reviews yet) Write a Review
SKU:
CSB-EP006091MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Cystatin-C (Cst3)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €878.00

Description

Recombinant Mouse Cystatin-C (Cst3) | CSB-EP006091MO | Cusabio

Alternative Name(s): Cystatin-3

Gene Names: Cst3

Research Areas: Cardiovascular

Organism: Mus musculus (Mouse)

AA Sequence: ATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 21-140aa

Sequence Info: Full Length of Mature Protein

MW: 20.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity.

Reference: "Transforming growth factor beta regulates cystatin C in serum-free mouse embryo (SFME) cells." Solem M., Rawson C., Lindburg K., Barnes D. Biochem. Biophys. Res. Commun. 172:945-951(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Cystatin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P21460

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose