Recombinant Mouse Collectrin (Cltrn), partial | CSB-EP861705MO

Recombinant Mouse Collectrin (Cltrn), partial | CSB-EP861705MO | Cusabio

Alternative Name(s): Transmembrane protein 27

Gene Names: Cltrn

Research Areas: Signal Transduction

Organism: Mus musculus (Mouse)

AA Sequence: ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 15-141aa

Sequence Info: Extracellular Domain

MW: 34.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Regulator of SNARE complex function. Stimulator of beta cell replication.

Reference: "Collectrin, a collecting duct-specific transmembrane glycoprotein, is a novel homolog of ACE2 and is developmentally regulated in embryonic kidneys." Zhang H., Wada J., Hida K., Tsuchiyama Y., Hiragushi K., Shikata K., Wang H., Lin S., Kanwar Y.S., Makino H. J. Biol. Chem. 276:17132-17139(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Regulator of SNARE complex function. Stimulator of beta cell replication.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families: TMEM27 family

Tissue Specificity: Kidney; collecting ducts. Pancreas; beta cells of islets.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9ESG4

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A