Recombinant Mouse cGMP-specific 3, 5-cyclic phosphodiesterase (Pde5a), partial | CSB-EP807017MO

(No reviews yet) Write a Review
SKU:
CSB-EP807017MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse cGMP-specific 3, 5-cyclic phosphodiesterase (Pde5a), partial
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP807017MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pde5a.
€298.00 - €1,702.00

Description

Recombinant Mouse cGMP-specific 3, 5-cyclic phosphodiesterase (Pde5a), partial | CSB-EP807017MO | Cusabio

Alternative Name(s): cGMP-binding cGMP-specific phosphodiesterase (CGB-PDE) (Pde5)

Gene Names: Pde5a

Research Areas: Cancer

Organism: Mus musculus (Mouse)

AA Sequence: DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRN

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 154-320aa

Sequence Info: Partial

MW: 26.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase catalyzes the specific hydrolysis of cGMP to 5'-GMP. Specifically regulates nitric-oxide-generated cGMP.

Reference: "cGMP catabolism by phosphodiesterase 5A regulates cardiac adrenergic stimulation by NOS3-dependent mechanism." Takimoto E., Champion H.C., Belardi D., Moslehi J., Mongillo M., Mergia E., Montrose D.C., Isoda T., Aufiero K., Zaccolo M., Dostmann W.R., Smith C.J., Kass D.A. Circ. Res. 96:100-109(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8CG03

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose