Recombinant Mouse CD82 antigen (Cd82) , partial | CSB-EP004961MO

(No reviews yet) Write a Review
SKU:
CSB-EP004961MO
Availability:
13 - 23 Working Days
  • Recombinant Mouse CD82 antigen (Cd82) , partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00

Description

Recombinant Mouse CD82 antigen (Cd82) , partial | CSB-EP004961MO | Cusabio

Alternative Name(s): C33 antigenIA4Inducible membrane protein R2Metastasis suppressor Kangai-1 homolog; CD82

Gene Names: Cd82

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: DKLKKEMGNTVMDIIRNYTANATSSREEAWDYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENF

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 111-227aa

Sequence Info: Extracellular Domain

MW: 29.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.

Reference: The mouse C2C12 myoblast cell surface N-linked glycoproteome identification, glycosite occupancy, and membrane orientation.Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.Mol. Cell. Proteomics 8:2555-2569(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.

Involvement in disease:

Subcellular Location: Membrane, Multi-pass membrane protein

Protein Families: Tetraspanin (TM4SF) family

Tissue Specificity: Highest expression in the spleen and the kidney. Low expression in skeletal muscle and in the heart.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P40237

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose