Recombinant Mouse Cathepsin L1 (Ctsl1), partial | CSB-EP006193MO

Recombinant Mouse Cathepsin L1 (Ctsl1), partial | CSB-EP006193MO | Cusabio

Alternative Name(s): Cathepsin L (Major excreted protein) (MEP) (p39 cysteine proteinase) (Ctsl1)

Gene Names: Ctsl

Research Areas: Signal Transduction

Organism: Mus musculus (Mouse)

AA Sequence: IPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGT

Source: E.coli

Tag Info: N-terminal 6xHis-taggedand C-terminal Myc-tagged

Expression Region: 114-288aa

Sequence Info: Partial

MW: 26.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Important for the overall degradation of proteins in lysosomes.

Reference: "High throughput quantitative glycomics and glycoform-focused proteomics of murine dermis and epidermis." Uematsu R., Furukawa J., Nakagawa H., Shinohara Y., Deguchi K., Monde K., Nishimura S. Mol. Cell. Proteomics 4:1977-1989(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Important for the overall degradation of proteins in lysosomes.

Involvement in disease:

Subcellular Location: Lysosome

Protein Families: Peptidase C1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P06797

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A