Recombinant Mouse C-X-C motif chemokine 2 protein (Cxcl2) | CSB-RP092274m

Recombinant Mouse C-X-C motif chemokine 2 protein (Cxcl2) | CSB-RP092274m | Cusabio

Alternative Name(s): Macrophage inflammatory protein 2 ;MIP2

Gene Names: Cxcl2

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 28-100aa

Sequence Info: Full Length of Mature Protein

MW: 11.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Chotactic for human polymorphonuclear leukocytes but does not induce chokinesis or an oxidative burst.

Reference: Cloning and characterization of cDNAs for murine macrophage inflammatory protein 2 and its human homologues.Tekamp-Olson P., Gallegos C., Bauer D., McClain J., Sherry B., Fabre M., van Deventer S., Cerami A.J. Exp. Med. 172:911-919(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Intercrine alpha (chemokine CxC) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P10889

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A