Cusabio Mouse Recombinants
Recombinant Mouse C-X-C motif chemokine 10 (Cxcl10) | CSB-EP006240MO
- SKU:
- CSB-EP006240MO
- Availability:
- 13 - 23 Working Days
Description
Recombinant Mouse C-X-C motif chemokine 10 (Cxcl10) | CSB-EP006240MO | Cusabio
Alternative Name(s): 10KDA interferon gamma-induced protein Short name: Gamma-IP10 Short name: IP-10
Gene Names: Cxcl10
Research Areas: Others
Organism: Mus musculus (Mouse)
AA Sequence: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 22-98aa
Sequence Info: Full Length of Mature Protein
MW: 35.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: In addition to its role as a proinflammatory cytokine, may participate in T-cell effector function and perhaps T-cell development.
Reference: "Structure of mouse IP-10, a chemokine."Jabeen T., Leonard P., Jamaluddin H., Acharya K.R.Acta Crystallogr. D 64:611-619(2008)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P17515
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A