Recombinant Mouse Beta-tectorin (Tectb) | CSB-EP023371MOb9

(No reviews yet) Write a Review
SKU:
CSB-EP023371MOb9
Availability:
13 - 23 Working Days
€352.00 - €1,702.00

Description

Recombinant Mouse Beta-tectorin (Tectb) | CSB-EP023371MOb9 | Cusabio

Alternative Name(s): Tectb; Beta-tectorin

Gene Names: Tectb

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: KSCTPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDSTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSTKKEAPFVLETSEIGSDLFAGVEAKGLSVRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGKDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVNCDKRKRMLRDQTGGVLVVELSLRSRA

Source: E.coli

Tag Info: N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged

Expression Region: 18-305aa

Sequence Info: Full Length of Mature Protein

MW: 39.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: One of the major non-collagenous components of the tectorial membrane. The tectorial membrane is an extracellular matrix of the inner ear that covers the neuroepithelium of the cochlea and contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals.

Reference: "The mouse adducin gene family: alternative splicing and chromosomal localization." Suriyapperuma S.P., Lozovatsky L., Ciciotte S.L., Peters L.L., Gilligan D.M. Mamm. Genome 11:16-23(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O08524

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose