Recombinant Mouse Beta-defensin 33 (Defb33) | CSB-EP655157MO

Recombinant Mouse Beta-defensin 33 (Defb33) | CSB-EP655157MO | Cusabio

Alternative Name(s): Defensin, beta 33

Gene Names: Defb33

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: RKRNSKFRPCEKMGGICKSQKTHGCSILPAECKSRYKHCCRL

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 21-62aa

Sequence Info: Full Length of Mature Protein

MW: 24.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Has antibacterial activity.

Reference: "Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract." Patil A.A., Cai Y., Sang Y., Blecha F., Zhang G. Physiol. Genomics 23:5-17(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has antibacterial activity.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Beta-defensin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q30KN3

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A