Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial | CSB-YP015007MO1

(No reviews yet) Write a Review
SKU:
CSB-YP015007MO1
Availability:
3 - 7 Working Days
  • Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,135.00

Description

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial | CSB-YP015007MO1 | Cusabio

Alternative Name(s): B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1; CD20

Gene Names: Ms4a1

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 111-291aa

Sequence Info: Partial

MW: 22.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This protein may be involved in the regulation of B-cell activation and proliferation.

Reference: The oligomeric nature of the murine Fc epsilon RII/CD23. Implications for function.Dierks S.E., Bartlett W.C., Edmeades R.L., Gould H.J., Rao M., Conrad D.H.J. Immunol. 150:2372-2382(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This protein may be involved in the regulation of B-cell activation and proliferation.

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein, Cell membrane, Lipid-anchor

Protein Families: MS4A family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P19437

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose