Cusabio Mouse Recombinants
Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10), partial | CSB-YP021710MO
- SKU:
 - CSB-YP021710MO
 - Availability:
 - 3 - 7 Working Days
 
Description
Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10), partial | CSB-YP021710MO | Cusabio
Alternative Name(s): D-serine transporter Solute carrier family 7 member 10
Gene Names: Slc7a10
Research Areas: Others
Organism: Mus musculus (Mouse)
AA Sequence: WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITDKPLKTQ
Source: Yeast
Tag Info: N-terminal 6xHis-sumostar-tagged
Expression Region: 475-530aa
Sequence Info: Partial
MW: 22.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Sodium-independent, high affinity transport of small neutral D- and L-amino acids and amino acid-related compounds. May play a role in the modulation of glutamatergic transmission through mobilization of D-serine at the glutamatergic synapse.
Reference: "Identification and characterization of a Na+-independent neutral amino acid transporter that associates with the 4F2 heavy chain and exhibits substrate selectivity for small neutral D- and L- amino acids." Fukasawa Y., Segawa H., Kim J.Y., Chairoungdua A., Kim D.K., Matsuo H., Cha S.H., Endou H., Kanai Y. J. Biol. Chem. 275:9690-9698(2000)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Sodium-independent, high affinity transport of small neutral D- and L-amino acids and amino acid-related compounds. May play a role in the modulation of glutamatergic transmission through mobilization of D-serine at the glutamatergic synapse.
Involvement in disease:
Subcellular Location: Membrane, Multi-pass membrane protein
Protein Families: Amino acid-polyamine-organocation (APC) superfamily
Tissue Specificity: Highly expressed in brain and lung, and to a lesser extent in placenta and small intestine.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P63115
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A