Recombinant Mouse Anterior gradient protein 2 homolog (Agr2) | CSB-YP001458MO

(No reviews yet) Write a Review
SKU:
CSB-YP001458MO
Availability:
25 - 35 Working Days
  • Recombinant Mouse Anterior gradient protein 2 homolog (Agr2)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€339.00 - €551.00

Description

Recombinant Mouse Anterior gradient protein 2 homolog (Agr2) | CSB-YP001458MO | Cusabio

Alternative Name(s): Protein Gob-4 Secreted cement gland protein XAG-2 homolog

Gene Names: Agr2

Research Areas: Cancer

Organism: Mus musculus (Mouse)

AA Sequence: KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 21-175aa

Sequence Info: Full Length of Mature Protein

MW: 19.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Required for MUC2 post-transcriptional synthesis and secretion. May play a role in the production of mucus by intestinal cells. Proto-oncogene that may play a role in cell migration, cell differentiation and cell growth (By similarity). Promotes cell adhesion (By similarity).

Reference: "The protein disulfide isomerase AGR2 is essential for production of intestinal mucus." Park S.-W., Zhen G., Verhaeghe C., Nakagami Y., Nguyenvu L.T., Barczak A.J., Killeen N., Erle D.J. Proc. Natl. Acad. Sci. U.S.A. 106:6950-6955(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O88312

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose