Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial (H294F, H296F, Y297C, H305F) | CSB-MP013104MO1(M)e5

Recombinant Mouse Alpha-2-macroglobulin receptor-associated protein (Lrpap1), partial (H294F, H296F, Y297C, H305F) | CSB-MP013104MO1(M)e5 | Cusabio

Alternative Name(s): Heparin-binding protein 44

Gene Names: Lrpap1

Research Areas: Cardiovascular

Organism: Mus musculus (Mouse)

AA Sequence: GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKFNFCQKQLEISFQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL

Source: Mammalian cell

Tag Info: N-terminal GFP-tagged and C-terminal 6xHis-tagged

Expression Region: 248-360aa(H294F,H296F,Y297C,H305F)

Sequence Info: Partial

MW: 43.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Molecular chaperone for LDL receptor-related proteins that may regulate their ligand binding activity along the secretory pathway

Reference: "Lipoprotein receptor-related protein in brain and in cultured neurons of mice deficient in receptor-associated protein and transgenic for apolipoprotein E4 or amyloid precursor protein." Umans L., Serneels L., Lorent K., Dewachter I., Tesseur I., Moechars D., Van Leuven F. Neuroscience 94:315-321(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P55302

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A