Cusabio Mouse Recombinants
Recombinant Mouse Acetylcholine receptor subunit alpha (Chrna1), partial | CSB-EP005386MOa2
- SKU:
- CSB-EP005386MOa2
- Availability:
- 3 - 7 Working Days
Description
Recombinant Mouse Acetylcholine receptor subunit alpha (Chrna1), partial | CSB-EP005386MOa2 | Cusabio
Alternative Name(s): Chrna1; Acra; Acetylcholine receptor subunit alpha
Gene Names: Chrna1
Research Areas: Others
Organism: Mus musculus (Mouse)
AA Sequence: SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 21-230aa
Sequence Info: Extracellular Domain
MW: 40.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma mbrane.
Reference: Crystal structure of the Extracellular domain of nAChR alpha1 bound to alpha-bungarotoxin at 1.94 A resolution.Dellisanti C.D., Yao Y., Stroud J.C., Wang Z.Z., Chen L.Nat. Neurosci. 10:953-962(2007)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Involvement in disease:
Subcellular Location: Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein
Protein Families: Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-1/CHRNA1 sub-subfamily
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P04756
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A