Recombinant Mouse Acetylcholine receptor subunit alpha (Chrna1), partial | CSB-EP005386MOa2

Recombinant Mouse Acetylcholine receptor subunit alpha (Chrna1), partial | CSB-EP005386MOa2 | Cusabio

Alternative Name(s): Chrna1; Acra; Acetylcholine receptor subunit alpha

Gene Names: Chrna1

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 21-230aa

Sequence Info: Extracellular Domain

MW: 40.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma mbrane.

Reference: Crystal structure of the Extracellular domain of nAChR alpha1 bound to alpha-bungarotoxin at 1.94 A resolution.Dellisanti C.D., Yao Y., Stroud J.C., Wang Z.Z., Chen L.Nat. Neurosci. 10:953-962(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Involvement in disease:

Subcellular Location: Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein

Protein Families: Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-1/CHRNA1 sub-subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P04756

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A