Recombinant Mannheimia haemolytica Leukotoxin (lktA), partial | CSB-EP314743ESE

Recombinant Mannheimia haemolytica Leukotoxin (lktA), partial | CSB-EP314743ESE | Cusabio

Alternative Name(s): lktA; Leukotoxin; Lkt

Gene Names: lktA

Research Areas: Others

Organism: Mannheimia haemolytica (Pasteurella haemolytica)

AA Sequence: IGTSHNDIFKGSKFNDAFNGGDGVDTIDGNDGNDRLFGGKGDDIIDGGNGDDFIDGGKGNDLLHGGKGDDIFVHRQGDGNDSITESEGNDKLSFSDSNLKDLTFEKVNHHLVITNTKQEKVTIQNWFREAEFAKTIQNYVATRDDKIEEIIGQNGERITSKQVDELIEKGNGKIAQSELTKVVDNYQLLKYSRDASNSLDKLISSASAFTSSNDSRNVLASPTSMLDPSLSSIQFARAA

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 715-953aa

Sequence Info: Partial

MW: 53 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Pasteurella leukotoxins are exotoxins that attack host leukocytes and especially polymorphonuclear cells, by causing cell rupture. The leukotoxin binds to the host LFA-1 integrin and induces a signaling cascade leading to many biological effects, including tyrosine phosphorylation of the CD18 tail, elevation of the intracellular Ca2+ and lysis of the host cell . This leukotoxin is a major contributor to the pathogenesis of lung injury in ovine pneumonic pasteurellosis. It has also weak holytic activity.

Reference: Sequence diversity and molecular evolution of the leukotoxin (lktA) gene in bovine and ovine strains of Mannheimia (Pasteurella) haemolytica.Davies R.L., Whittam T.S., Selander R.K.J. Bacteriol. 183:1394-1404(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Pasteurella leukotoxins are exotoxins that attack host leukocytes and especially polymorphonuclear cells, by causing cell rupture. The leukotoxin binds to the host LFA-1 integrin and induces a signaling cascade leading to many biological effects, including tyrosine phosphorylation of the CD18 tail, elevation of the intracellular Ca(2+) and lysis of the host cell (By similarity). This leukotoxin is a major contributor to the pathogenesis of lung injury in ovine pneumonic pasteurellosis. It has also weak hemolytic activity.

Involvement in disease:

Subcellular Location: Secreted, Host cell membrane, Multi-pass membrane protein

Protein Families: RTX prokaryotic toxin (TC 1.C.11) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0C085

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A