Cusabio Macaca fascicularis Recombinants
Recombinant Macaca fascicularis Transthyretin (TTR) | CSB-MP025270MOV
- SKU:
- CSB-MP025270MOV
- Availability:
- 3 - 7 Working Days
Description
Recombinant Macaca fascicularis Transthyretin (TTR) | CSB-MP025270MOV | Cusabio
Alternative Name(s): Prealbumin
Gene Names: TTR
Research Areas: Cardiovascular
Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
AA Sequence: GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE
Source: Mammalian cell
Tag Info: N-terminal 6xHis-tagged
Expression Region: 21-147aa
Sequence Info: Full Length of Mature Protein
MW: 17.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain (By similarity).
Reference: "Isolation and characterization of cDNA for macaque neurological disease genes."Kusuda J., Osada N., Hida M., Sugano S., Hashimoto K. Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain (By similarity).
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Transthyretin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q8HXW1
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A