Recombinant Macaca fascicularis Transthyretin (TTR) | CSB-MP025270MOV

Recombinant Macaca fascicularis Transthyretin (TTR) | CSB-MP025270MOV | Cusabio

Alternative Name(s): Prealbumin

Gene Names: TTR

Research Areas: Cardiovascular

Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

AA Sequence: GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE

Source: Mammalian cell

Tag Info: N-terminal 6xHis-tagged

Expression Region: 21-147aa

Sequence Info: Full Length of Mature Protein

MW: 17.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain (By similarity).

Reference: "Isolation and characterization of cDNA for macaque neurological disease genes."Kusuda J., Osada N., Hida M., Sugano S., Hashimoto K. Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain (By similarity).

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Transthyretin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8HXW1

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A