Recombinant Loxosceles amazonica Phospholipase D LamSicTox-alphaIC1 | CSB-EP495649LQU

(No reviews yet) Write a Review
SKU:
CSB-EP495649LQU
Availability:
13 - 23 Working Days
  • Recombinant Loxosceles amazonica Phospholipase D LamSicTox-alphaIC1
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Loxosceles amazonica Phospholipase D LamSicTox-alphaIC1 | CSB-EP495649LQU | Cusabio

Alternative Name(s): Dermonecrotic toxin LamSicTox-alphaIC1; EC 4.6.1.-; Phospholipase D; PLD; Sphingomyelin phosphodiesterase D; SMD; SMase D; Sphingomyelinase D; Fragment

Gene Names: N/A

Research Areas: Others

Organism: Loxosceles amazonica (Recluse spider)

AA Sequence: WIMGHMVNNINQIEEFVSLGANSIETDVSFDKKANPEYTYHGTPCDCGRDCLRWEYFKDFLNGLRKATTPGDAKYREKLILVVFDLKTGSLYDNQAYDAGKSLAKNLLEYYWNNGNNGGRAYIVLSIPNLAHYKLVTGFKETLKDEGHEDLLEKVGHDFSGNDDIPDIESAYKKAGVTGHVWQSDGITNCLPRTLKRVILAIANRDSGSGIINKVYYWTVDKRSTTRDSLEAGVDGIMTNYPDVIADVLSEAAYKDKYRIATYDDNPWETFKA

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-273aa

Sequence Info: Full Length

MW: 34.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the hydrolysis of sphingomyelin. May also acts on other phosphatidyl esters. Induces complent-dependent holysis, dermonecrosis, blood vessel permeability and platelet aggregation .

Reference: Molecular evolution, functional variation, and proposed nomenclature of the gene family that includes sphingomyelinase D in sicariid spider venoms.Binford G.J., Bodner M.R., Cordes M.H., Baldwin K.L., Rynerson M.R., Burns S.N., Zobel-Thropp P.A.Mol. Biol. Evol. 26:547-566(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the hydrolysis of sphingomyelin. May also act on other phosphatidyl esters. Induces complement-dependent hemolysis, dermonecrosis, blood vessel permeability and platelet aggregation (By similarity).

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Arthropod phospholipase D family, Class II subfamily

Tissue Specificity: Expressed by the venom gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: C0JAZ9

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose