Recombinant Lolium perenne Major pollen allergen Lol p 5a (LOLPIB) | CSB-EP670318LQK

(No reviews yet) Write a Review
SKU:
CSB-EP670318LQK
Availability:
3 - 7 Working Days
  • Recombinant Lolium perenne Major pollen allergen Lol p 5a (LOLPIB)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Lolium perenne Major pollen allergen Lol p 5a (LOLPIB) | CSB-EP670318LQK | Cusabio

Alternative Name(s): Allergen Lol p Ib Allergen Lol p Va Allergen: Lol p 5a

Gene Names: LOLPIB

Research Areas: Allergen

Organism: Lolium perenne

AA Sequence: ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQSLISLLIYY

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 26-307aa

Sequence Info: Full Length of Mature Protein

MW: 48.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Isolation of cDNA encoding a newly identified major allergenic protein of rye-grass pollen: intracellular targeting to the amyloplast." Singh M.B., Hough T., Theerakulpisut P., Avjioglu A., Davies S., Smith P.M., Taylor P., Simpson R.J., Ward L.D., McCluskey J., Puy R., Knox R.B.Proc. Natl. Acad. Sci. U.S.A. 88:1384-1388(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: Poa p IX/Phl p VI allergen family

Tissue Specificity: Pollen, starch granules.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q40240

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose