Cusabio Virus & Bacteria Recombinants
Recombinant Listeria monocytogenes serotype 4b Internalin-A (inlA), partial | CSB-YP758331LAAD
- SKU:
- CSB-YP758331LAAD
- Availability:
- 25 - 35 Working Days
Description
Recombinant Listeria monocytogenes serotype 4b Internalin-A (inlA), partial | CSB-YP758331LAAD | Cusabio
Alternative Name(s): inlA; LMOf2365_0471; Internalin A
Gene Names: inlA
Research Areas: Others
Organism: Listeria monocytogenes serotype 4b (strain F2365)
AA Sequence: QFSINSYTATFDNDGVTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSANSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPANDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTSTMNAYDPYNSKEASLPTT
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 562-770aa
Sequence Info: Partial
MW: 24.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Mediates the entry of Listeria monocytogenes into cells.
Reference: Whole genome comparisons of serotype 4b and 1/2a strains of the food-borne pathogen Listeria monocytogenes reveal new insights into the core genome components of this species.Nelson K.E., Fouts D.E., Mongodin E.F., Ravel J., DeBoy R.T., Kolonay J.F., Rasko D.A., Angiuoli S.V., Gill S.R., Paulsen I.T., Peterson J.D., White O., Nelson W.C., Nierman W.C., Beanan M.J., Brinkac L.M., Daugherty S.C., Dodson R.J. , Durkin A.S., Madupu R., Haft D.H., Selengut J., Van Aken S.E., Khouri H.M., Fedorova N., Forberger H.A., Tran B., Kathariou S., Wonderling L.D., Uhlich G.A., Bayles D.O., Luchansky J.B., Fraser C.M.Nucleic Acids Res. 32:2386-2395(2004)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Mediates the entry of Listeria monocytogenes into cells.
Involvement in disease:
Subcellular Location: Secreted, cell wall, Peptidoglycan-anchor
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q723K6
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A