Recombinant Leishmania donovani Transitional endoplasmic reticulum ATPase, putative (LDBPK_361420), partial | CSB-EP2530LOE

Recombinant Leishmania donovani Transitional endoplasmic reticulum ATPase, putative (LDBPK_361420), partial | CSB-EP2530LOE | Cusabio

Alternative Name(s): /

Gene Names: LDBPK_361420

Research Areas: Others

Organism: Leishmania donovani (strain BPK282A1)

AA Sequence: NKLIVEEPYNDDNSVVSLNPKRMEELNIFRGDTVLVKGKKHRSTVCIAMEDDECPPEKIKMNKVARRNIRIHLGDTIRIAPCKD

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 15-98aa

Sequence Info: Partial

MW: 13.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "Whole genome sequencing of Leishmania donovani clinical lines reveals dynamic variation related to drug resistance." Downing T., Imamura H., Sanders M., Decuypere S., Hertz-Fowler C., Clark T.G., Rijal S., Sundar S., Quail M.A., De Doncker S., Maes I., Vanaerschot M., Stark O., Schonian G., Dujardin J.C., Berriman M. Submitted (FEB-2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: E9BTK1

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A