Cusabio Virus & Bacteria Recombinants
Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2) | CSB-YP304437HYE
- SKU:
- CSB-YP304437HYE
- Availability:
- 25 - 35 Working Days
Description
Recombinant Hypocrea jecorina Hydrophobin-2 (hfb2) | CSB-YP304437HYE | Cusabio
Alternative Name(s): Hydrophobin II
Gene Names: hfb2
Research Areas: Others
Organism: Hypocrea jecorina (Trichoderma reesei)
AA Sequence: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 16-86aa
Sequence Info: Full Length of Mature Protein
MW: 9.2 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Responsible for spore hydrophobicity and protection.
Reference: "Differential expression of the vegetative and spore-bound hydrophobins of Trichoderma reesei: cloning and characterization of the hfb2 gene." Nakari-Setaelae T., Aro N., Ilmen M., Munoz G., Kalkkinen N., Penttilae M. Eur. J. Biochem. 248:415-423(1997)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Responsible for spore hydrophobicity and protection.
Involvement in disease:
Subcellular Location: Spore wall, Secreted, cell wall
Protein Families: Cerato-ulmin hydrophobin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P79073
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A