Recombinant Human Zinc finger protein GLI1 (GLI1), partial | CSB-EP009499HU

Recombinant Human Zinc finger protein GLI1 (GLI1), partial | CSB-EP009499HU | Cusabio

Alternative Name(s): Glioma-associated oncogeneOncogene GLI

Gene Names: GLI1

Research Areas: Developmental Biology

Organism: Homo sapiens (Human)

AA Sequence: QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 921-1106aa

Sequence Info: Partial

MW: 23.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Acts as a transcriptional activator. May regulate the transcription of specific genes during normal development. May play a role in craniofacial development and digital development, as well as development of the central nervous syst and gastrointestinal tract. Mediates SHH signaling and thus cell proliferation and differentiation.

Reference: Polymorphic variants of the human oncogene GLI1 function similarly.Yoon J.W., Kent P., Clark A., Patterson J., Villavicencio E., Iannaccone P., Walterhouse D.A novel splice variant of GLI1 that promotes glioblastoma cell migration and invasion.Lo H.W., Zhu H., Cao X., Aldrich A., Ali-Osman F.Cancer Res. 69:6790-6798(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Acts as a transcriptional activator

Involvement in disease:

Subcellular Location: Cytoplasm, Nucleus

Protein Families: GLI C2H2-type zinc-finger protein family

Tissue Specificity: Detected in testis (at protein level) (PubMed:2105456). Testis, myometrium and fallopian tube. Also expressed in the brain with highest expression in the cerebellum, optic nerve and olfactory tract (PubMed:19878745). Isoform 1 is detected in brain, spleen, pancreas, liver, kidney and placenta; isoform 2 is not detectable in these tissues (PubMed:19706761).

Paythway: cAMPsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P08151

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM