Cusabio Human Recombinants
Recombinant Human Visinin-like protein 1 (VSNL1) | CSB-EP025933HU
- SKU:
- CSB-EP025933HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Visinin-like protein 1 (VSNL1) | CSB-EP025933HU | Cusabio
Alternative Name(s): Hippocalcin-like protein 3
Gene Names: VSNL1
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-191aa
Sequence Info: Full Length
MW: 49 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Regulates the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.
Reference: "Peptide conservation between avian and mammalian visinin-like proteins." Bellingham J. Submitted (DEC-1997)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Regulates (in vitro) the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.
Involvement in disease:
Subcellular Location:
Protein Families: Recoverin family
Tissue Specificity: Brain and retina. Neuron-specific in the central and peripheral nervous system. Increased in the cerebrospinal fluid of Alzheimer disease patients (at protein level).
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P62760
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM