Recombinant Human Vesicle-associated membrane protein 7 (VAMP7), partial | CSB-EP025785HU

Recombinant Human Vesicle-associated membrane protein 7 (VAMP7), partial | CSB-EP025785HU | Cusabio

Alternative Name(s): Synaptobrevin-like protein 1Tetanus-insensitive VAMP ;Ti-VAMP

Gene Names: VAMP7

Research Areas: Cell Cycle

Organism: Homo sapiens (Human)

AA Sequence: AILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKN

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-186aa

Sequence Info: Cytoplasmic Domain

MW: 25 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in the targeting and/or fusion of transport vesicles to their target mbrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation.

Reference: Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation.

Involvement in disease:

Subcellular Location: Cytoplasmic vesicle, secretory vesicle membrane, Single-pass type IV membrane protein, Golgi apparatus, trans-Golgi network membrane, Single-pass type IV membrane protein, Late endosome membrane, Single-pass type IV membrane protein, Lysosome membrane, Single-pass type IV membrane protein, Endoplasmic reticulum membrane, Single-pass type IV membrane protein, Cytoplasmic vesicle, phagosome membrane, Single-pass type IV membrane protein, Cell junction, synapse, synaptosome

Protein Families: Synaptobrevin family

Tissue Specificity: Detected in all tissues tested.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P51809

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM