Recombinant Human V-set and immunoglobulin domain-containing protein 1 (VSIG1), partial | CSB-MP769803HU1

Recombinant Human V-set and immunoglobulin domain-containing protein 1 (VSIG1), partial | CSB-MP769803HU1 | Cusabio

Alternative Name(s): Cell surface A33 antigen (Glycoprotein A34) (GPA34)

Gene Names: VSIG1

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: VQVTIPDGFVNVTVGSNVTLICIYTTTVASREQLSIQWSFFHKKEMEPISIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNFEQGYYQCTAINRLGNSSCEIDLTSSHPE

Source: Mammalian cell

Tag Info: N-terminal 10xHis-tagged

Expression Region: 22-232aa

Sequence Info: Extracellular Domain

MW: 26.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Decreased expression of V-set and immunoglobulin domain containing 1 (VSIG1) is associated with poor prognosis in primary gastric cancer." Chen Y., Pan K., Li S., Xia J., Wang W., Chen J., Zhao J., Lu L., Wang D., Pan Q., Wang Q., Li Y., He J., Li Q. J Surg Oncol 106:286-293(2012)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity: Detected only in stomach mucosa and testis, and to a much lesser level in pancreas (at protein level). Detected in gastric cancers (31%), esophageal carcinomas (50%) and ovarian cancers (23%).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q86XK7

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM