Recombinant Human Ubiquitin-like-conjugating enzyme ATG10 (ATG10) | CSB-EP861988HU

Recombinant Human Ubiquitin-like-conjugating enzyme ATG10 (ATG10) | CSB-EP861988HU | Cusabio

Alternative Name(s): Autophagy-related protein 10

Gene Names: ATG10

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-220aa

Sequence Info: Full Length

MW: 52.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: E2-like enzyme involved in autophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for autophagy. Likely serves as an ATG5-recognition molecule. Not involved in ATG12 conjugation to ATG3. Plays a role in adenovirus-mediated cell lysis.

Reference: "Human adenovirus type 5 induces cell lysis through autophagy and autophagy-triggered caspase activity." Jiang H., White E.J., Rios-Vicil C.I., Xu J., Gomez-Manzano C., Fueyo J. J. Virol. 85:4720-4729(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: E2-like enzyme involved in autophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for autophagy. Likely serves as an ATG5-recognition molecule. Not involved in ATG12 conjugation to ATG3 (By similarity). Plays a role in adenovirus-mediated cell lysis.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: ATG10 family

Tissue Specificity:

Paythway: Autophagy-animal

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9H0Y0

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM