Cusabio Human Recombinants
Recombinant Human U7 snRNA-associated Sm-like protein LSm10 (LSM10) | CSB-EP836169HU
- SKU:
- CSB-EP836169HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human U7 snRNA-associated Sm-like protein LSm10 (LSM10) | CSB-EP836169HU | Cusabio
Alternative Name(s): LSM10U7 snRNA-associated Sm-like protein LSm10
Gene Names: LSM10
Research Areas: Transcription
Organism: Homo sapiens (Human)
AA Sequence: MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-123aa
Sequence Info: Full Length
MW: 30.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed. Required for cell cycle progression from G1 to S phases. Binds specifically to U7 snRNA. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner.
Reference: Purified U7 snRNPs lack the Sm proteins D1 and D2 but contain Lsm10, a new 14KDA Sm D1-like protein.Pillai R.S., Will C.L., Luehrmann R., Schuemperli D., Mueller B.EMBO J. 20:5470-5479(2001)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed. Required for cell cycle progression from G1 to S phases. Binds specifically to U7 snRNA. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner.
Involvement in disease:
Subcellular Location: Nucleus
Protein Families: SnRNP Sm proteins family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q969L4
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM