Recombinant Human Tryptophan 2, 3-dioxygenase (TDO2) | CSB-EP023351HUb2

Recombinant Human Tryptophan 2, 3-dioxygenase (TDO2) | CSB-EP023351HUb2 | Cusabio

Alternative Name(s): Tryptamin 2,3-dioxygenase (Tryptophan oxygenase) (TO) (TRPO) (Tryptophan pyrrolase) (Tryptophanase) (TDO)

Gene Names: TDO2

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged

Expression Region: 1-406aa

Sequence Info: Full Length

MW: 66.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Heme-dependent dioxygenase that catalyzes the oxidative cleavage of the L-tryptophan pyrrole ring and converts L-tryptophan to N-formyl-L-kynurenine. Catalyzes the oxidative cleavage of the indole moiety.

Reference: "A multivariate analysis of 59 candidate genes in personality traits: the temperament and character inventory." Comings D.E., Gade-Andavolu R., Gonzalez N., Wu S., Muhleman D., Blake H., Mann M.B., Dietz G., Saucier G., MacMurray J.P. Clin. Genet. 58:375-385(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Heme-dependent dioxygenase that catalyzes the oxidative cleavage of the L-tryptophan (L-Trp) pyrrole ring and converts L-tryptophan to N-formyl-L-kynurenine. Catalyzes the oxidative cleavage of the indole moiety.

Involvement in disease: Hypertryptophanemia (HYPTRP)

Subcellular Location:

Protein Families: Tryptophan 2,3-dioxygenase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P48775

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM