Cusabio Human Recombinants
Recombinant Human Trypsin-2 (PRSS2) (K23Q, S167G), partial | CSB-EP018814HU(M)e0
- SKU:
- CSB-EP018814HU(M)e0
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Trypsin-2 (PRSS2) (K23Q, S167G), partial | CSB-EP018814HU(M)e0 | Cusabio
Alternative Name(s): Trypsin-2(EC 3.4.21.4)(Anionic trypsinogen)(Serine protease 2)(Trypsin II)
Gene Names: PRSS2
Research Areas: Cell Biology
Organism: Homo sapiens (Human)
AA Sequence: APFDDDDQIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLGQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 16-247aa(K23Q,S167G)
Sequence Info: Partial
MW: 52.4 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: In the ileum, may be involved in defensin processing, including DEFA5.
Reference: "Paneth cell trypsin is the processing enzyme for human defensin-5." Ghosh D., Porter E., Shen B., Lee S.K., Wilk D., Drazba J., Yadav S.P., Crabb J.W., Ganz T., Bevins C.L. Nat. Immunol. 3:583-590(2002)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P07478
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A