Recombinant Human Trypsin-2 (PRSS2) (K23Q, S167G), partial | CSB-EP018814HU(M)e0

(No reviews yet) Write a Review
SKU:
CSB-EP018814HU(M)e0
Availability:
13 - 23 Working Days
€245.00 - €1,277.00

Description

Recombinant Human Trypsin-2 (PRSS2) (K23Q, S167G), partial | CSB-EP018814HU(M)e0 | Cusabio

Alternative Name(s): Trypsin-2(EC 3.4.21.4)(Anionic trypsinogen)(Serine protease 2)(Trypsin II)

Gene Names: PRSS2

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: APFDDDDQIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLGQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 16-247aa(K23Q,S167G)

Sequence Info: Partial

MW: 52.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: In the ileum, may be involved in defensin processing, including DEFA5.

Reference: "Paneth cell trypsin is the processing enzyme for human defensin-5." Ghosh D., Porter E., Shen B., Lee S.K., Wilk D., Drazba J., Yadav S.P., Crabb J.W., Ganz T., Bevins C.L. Nat. Immunol. 3:583-590(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P07478

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose