Cusabio Covid-19 Recombinants
Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial | CSB-EP023924HU
- SKU:
 - CSB-EP023924HU
 - Availability:
 - 3 - 7 Working Days
 
Description
Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial | CSB-EP023924HU | Cusabio
Target Name: TMPRSS2
Uniprot No: O15393
Species: Homo sapiens (Human)
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 106-492aa
Sequence Description: Partial
Target Protein Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Mol. Weight: 46.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test.
Biological Activity: N/A
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.