Recombinant Human Transgelin (TAGLN) | CSB-RP008044h

(No reviews yet) Write a Review
SKU:
CSB-RP008044h
Availability:
13 - 23 Working Days
  • Recombinant Human Transgelin (TAGLN)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Transgelin (TAGLN) | CSB-RP008044h | Cusabio

Alternative Name(s): 22KDA actin-binding protein;Protein WS3-10Smooth muscle protein 22-alpha ;SM22-alpha

Gene Names: TAGLN

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: ANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-201aa

Sequence Info: Full Length of Mature Protein

MW: 49.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Actin cross-linking/gelling protein . Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.

Reference: A novel gene encoding a smooth muscle protein is overexpressed in senescent human fibroblasts.Thweatt R., Lumpkin C.K. Jr., Goldstein S.Biochem. Biophys. Res. Commun. 187:1-7(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Actin cross-linking/gelling protein (By similarity). Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Calponin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q01995

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose