Recombinant Human Tissue factor (F3), partial | CSB-EP007928HU1

(No reviews yet) Write a Review
SKU:
CSB-EP007928HU1
Availability:
3 - 7 Working Days
  • Recombinant Human Tissue factor (F3), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Tissue factor (F3), partial | CSB-EP007928HU1 | Cusabio

Alternative Name(s): Coagulation factor IIIThromboplastin; CD142

Gene Names: F3

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 33-251aa

Sequence Info: Extracellular Domain

MW: 40.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited protolysis. TF plays a role in normal hostasis by initiating the cell-surface assbly and propagation of the coagulation protease cascade.

Reference: Human tissue factor cDNA sequence and chromosome localization of the gene.Scarpati E.M., Wen D., Broze G.J. Jr., Miletich J.P., Flandermeyer R.R., Siegel N.R., Sadler J.E.Biochemistry 26:5234-5238(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF

Involvement in disease:

Subcellular Location: Isoform 1: Membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted

Protein Families: Tissue factor family

Tissue Specificity: Lung, placenta and pancreas.

Paythway: Bcellreceptorsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P13726

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose