Recombinant Human Tetraspanin-7 (TSPAN7), partial | CSB-YP025165HU

(No reviews yet) Write a Review
SKU:
CSB-YP025165HU
Availability:
25 - 35 Working Days
  • Recombinant Human Tetraspanin-7 (TSPAN7), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€262.00 - €943.00

Description

Recombinant Human Tetraspanin-7 (TSPAN7), partial | CSB-YP025165HU | Cusabio

Alternative Name(s): Cell surface glycoprotein A15Membrane component chromosome X surface marker 1T-cell acute lymphoblastic leukemia-associated antigen 1 ;TALLA-1Transmembrane 4 superfamily member 2;; CD231

Gene Names: TSPAN7

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGI

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 113-223aa

Sequence Info: Extracellular Domain

MW: 14.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be involved in cell proliferation and cell motility.

Reference: Isolation of a novel cDNA clone showing marked similarity to ME491/CD63 superfamily.Emi N., Kitaori K., Seto M., Ueda R., Saito H., Takahashi T.Immunogenetics 37:193-198(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be involved in cell proliferation and cell motility.

Involvement in disease: Mental retardation, X-linked 58 (MRX58)

Subcellular Location: Membrane, Multi-pass membrane protein

Protein Families: Tetraspanin (TM4SF) family

Tissue Specificity: Not solely expressed in T-cells. Expressed in acute myelocytic leukemia cells of some patients.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P41732

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose