Recombinant Human Synaptotagmin-1 (SYT1), partial | CSB-EP023029HU

Recombinant Human Synaptotagmin-1 (SYT1), partial | CSB-EP023029HU | Cusabio

Alternative Name(s): Synaptotagmin I ;SytIp65

Gene Names: SYT1

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: KNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDA

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 99-416aa

Sequence Info: Cytoplasmic Domain

MW: 40.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May have a regulatory role in the mbrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca2+-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca2+-independent manner; these are neurexins, syntaxin and AP2.

Reference: Identification of a human synaptotagmin-1 mutation that perturbs synaptic vesicle cycling.Baker K., Gordon S.L., Grozeva D., van Kogelenberg M., Roberts N.Y., Pike M., Blair E., Hurles M.E., Chong W.K., Baldeweg T., Kurian M.A., Boyd S.G., Cousin M.A., Raymond F.L.J. Clin. Invest. 0:0-0(2015)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca(2+)-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca(2+)-independent manner; these are neurexins, syntaxin and AP2. Plays a role in dendrite formation by melanocytes

Involvement in disease: A SYT1 rare mutation has been found in a child with a severe neuro-developmental disorder. The individual harboring this variant shows early onset dyskinetic movement disorder, severe motor delay and profound cognitive impairment, suggesting that SYT1 may play a role in the pathogenesis of this neuro-developmental disorder.

Subcellular Location: Cytoplasmic vesicle, secretory vesicle membrane, Single-pass membrane protein, Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Single-pass membrane protein, Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane, Single-pass membrane protein, Cytoplasm

Protein Families: Synaptotagmin family

Tissue Specificity: Expressed in melanocytes (PubMed:23999003).

Paythway: Synapticvesiclecycle

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P21579

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM