Recombinant Human Striated muscle preferentially expressed protein kinase (SPEG), partial | CSB-EP022529HU

Recombinant Human Striated muscle preferentially expressed protein kinase (SPEG), partial | CSB-EP022529HU | Cusabio

Alternative Name(s): Aortic preferentially expressed protein 1 ;APEG-1

Gene Names: SPEG

Research Areas: Developmental Biology

Organism: Homo sapiens (Human)

AA Sequence: MQKARGTRGEDAGTRAPPSPGVPPKRAKVGAGGGAPVAVAGAPVFLRPLKNAAVCAGSDVRLRVVVSGTPQPSLRWFRDGQLLPAPAPEPSCLWLRRCGAQDAGVYSCMAQNE

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-113aa

Sequence Info: Partial

MW: 38.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Isoform 3 may have a role in regulating the growth and differentiation of arterial smooth muscle cells.

Reference: APEG-1, a novel gene preferentially expressed in aortic smooth muscle cells, is down-regulated by vascular injury.Hsieh C.-M., Yoshizumi M., Endege W.O., Kho C.-J., Jain M.K., Kashiki S., de Los Santos R., Lee W.-S., Perrella M.A., Lee M.-E.J. Biol. Chem. 271:17354-17359(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Isoform 3 may have a role in regulating the growth and differentiation of arterial smooth muscle cells.

Involvement in disease: Myopathy, centronuclear, 5 (CNM5)

Subcellular Location: Isoform 3: Nucleus

Protein Families: Protein kinase superfamily, CAMK Ser/Thr protein kinase family

Tissue Specificity: Isoform 1 is preferentially expressed in striated muscle. Non-kinase form such as isoform 3 is predominantly expressed in the aorta. Isoform 3 appears to be expressed only in highly differentiated ASMC in normal vessel walls and down-regulated in dedifferentiated ASMC in vivo. In response to vascular injuries ASMC dedifferentiate and change from a quiescent and contractile phenotype to a proliferative and synthetic phenotype. This proliferation of vascular smooth muscle cells is one of the most prominent features of atherosclerosis.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q15772

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM